PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000653903
Common NameMYB40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 415aa    MW: 46159.2 Da    PI: 8.3926
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000653903genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
    MDP0000653903 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.12.3e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
    MDP0000653903  67 RGPFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466894.49E-3012108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002493.0E-161461IPR001005SANT/Myb domain
CDDcd001678.92E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129420.42166116IPR017930Myb domain
SMARTSM007171.2E-1266114IPR001005SANT/Myb domain
PfamPF002493.1E-1367110IPR001005SANT/Myb domain
CDDcd001674.39E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGPF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRLRG  120
IDPNTHKPLS EVLDQNIGKE INNNNNIKLS PTYKSNEKAS VGSNELSLVE AVSSRHPTSA  180
SENRFNPVEV SSTSKLISSN GGSSKSLTHE GSPSSCRPCD FVGYFSFPHH NNQXNYGSSS  240
DMGLQAVNQN TTFSFLNQNP EFLQPSMSSS SAIFTAPPPP PTRVKPSISL PSDNSSTWDS  300
NANNSNSXGG GYFDSSAAFS WWPPEAVKSD DPEEIKWSEY LHNTSFLMGT HQASQPAXYS  360
EIKPESQSHI LSNSLSATSW HHQNXQQQQQ QALQASEMYT KDLQRLAVSF GQTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.169730.0bud| fruit| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366014.10.0PREDICTED: transcription factor MYB86
TrEMBLD9ZJ650.0D9ZJ65_MALDO; MYB domain class transcription factor
STRINGPOPTR_0005s00340.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.38e-89myb domain protein 55